NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold MXTR_Contig28763

Scaffold MXTR_Contig28763


Overview

Basic Information
Taxon OID2088090020 Open in IMG/M
Scaffold IDMXTR_Contig28763 Open in IMG/M
Source Dataset NameSample MX_TR1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterNational Research Council of Canada
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)515
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Stomach → Endoperitrophic Space → Rumen → Rumen Microbial Communities Of Musk Oxen From Alaska

Source Dataset Sampling Location
Location NameFairbanks, Alaska
CoordinatesLat. (o)64.880776Long. (o)-147.869984Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F050073Metagenome / Metatranscriptome145Y

Sequences

Protein IDFamilyRBSSequence
MXTR_00100580F050073N/AKKNSLLELMLKPGVLLLSLLIVSISSQKIGACTGTPKMRPIECFYGQVLNEDIPELKELLEKYRNGDDHEFADYLGDMFDKKEFREGRAENENQNPKILGKCGVHPKYQPFECYERNVLRRNRNQLKEAYDKLHGENLEEFNKIYIEYADAKQAYFADRKSGSAGMPRPIS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.