Scaffold LWFCAn_contig04682

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold LWFCAn_contig04682

Scaffold LWFCAn_contig04682

Overview

Basic Information
Taxon OID	2100351007 Open in IMG/M
Scaffold ID	LWFCAn_contig04682 Open in IMG/M
Source Dataset Name	Sediment microbial communities from Lake Washington, Seattle, for Methane and Nitrogen Cycles, sample from flow sorted aerobic plus nitrate
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	667
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Sediment → Freshwater Sediment Microbial Communities From Lake Washington, Seattle, Usa, For Methane And Nitrogen Cycles

Source Dataset Sampling Location
Location Name	Lake Washington, Seattle
Coordinates	Lat. (^o)	47.676484	Long. (^o)	-122.228394	Alt. (m)		Depth (m)	62
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F079376	Metagenome / Metatranscriptome	116	Y

Sequences

Protein ID	Family	RBS	Sequence
LWFCAn_06901940	F079376	GAG	MSDIMITRQPGRPCVSLAAKRVCRTTEEGGRQMRHRESDSLIVPVKAGNAAGGKEATHGSVV

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.