NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold BSEYNP_contig03635__length_1745___numreads_22

Scaffold BSEYNP_contig03635__length_1745___numreads_22


Overview

Basic Information
Taxon OID2100351008 Open in IMG/M
Scaffold IDBSEYNP_contig03635__length_1745___numreads_22 Open in IMG/M
Source Dataset NameHot spring microbial communities from Beowulf Spring, Yellowstone National Park, Wyoming, USA - YNP_Beowulf Spring_E
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1745
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (25.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Hot Spring Microbial Communities From Yellowstone National Park, Wyoming, Usa

Source Dataset Sampling Location
Location NameNorris Geyser Basin, Yellowstone National Park
CoordinatesLat. (o)44.733Long. (o)-110.708917Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F018963Metagenome / Metatranscriptome232N
F033507Metagenome / Metatranscriptome177Y

Sequences

Protein IDFamilyRBSSequence
BSEYNP_00864810F018963N/AMFPYVRGEDGSVTDTLIMSFRTKRVVYSKLSVNKFGHGYRTYVLLPANYVMYEAYRTGRGRASIKVSVIDVSPNPLSHFRVKDIWVMYEGVSPVTLVEDLPWNIRGIIEGNSGELPLYEYLE
BSEYNP_00864830F033507N/AMVRSKVVGVATSTTSTEGTLTVSLSVTCPSSATGCNVNQIDGVYYLYGVLDGYYYCGLQMGNQSVQYDWTLNVSATPTSLASGATVFVEVTYFDTLPNKPYYTETYPFTLNSNGEASGEFSVCMVPVTIFPESSVGIKVTSVKSTSDQPISYTSSGITIIPED
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.