NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold BSEYNP_contig04486__length_1462___numreads_39

Scaffold BSEYNP_contig04486__length_1462___numreads_39


Overview

Basic Information
Taxon OID2100351008 Open in IMG/M
Scaffold IDBSEYNP_contig04486__length_1462___numreads_39 Open in IMG/M
Source Dataset NameHot spring microbial communities from Beowulf Spring, Yellowstone National Park, Wyoming, USA - YNP_Beowulf Spring_E
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1462
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (25.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Hot Spring Microbial Communities From Yellowstone National Park, Wyoming, Usa

Source Dataset Sampling Location
Location NameNorris Geyser Basin, Yellowstone National Park
CoordinatesLat. (o)44.733Long. (o)-110.708917Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F006070Metagenome / Metatranscriptome382N
F011233Metagenome / Metatranscriptome293N

Sequences

Protein IDFamilyRBSSequence
BSEYNP_00634760F011233N/ALDYNWRVLAVAVPWFLPFVKGWRYHVPKLQRELLSGLPVPFTSEYTIINGQFPGYFVSAAVGTTDPNFITRASADGLTVIEVTVGELRDARVYRNQMGEPNILSYGSYIRGFPLPVYALSLSGDGLPFYQSIKIEVVPRNQPALITGFAANIIEIYDVDLFKESVKEFFESITPSPSTVPTSPGFVAEEVVSAKLPVKVT
BSEYNP_00634770F006070AGGMTLYPYLVVDLPITDTNTHTYRTNPFNPLTPTQPGISLVRLGESVPPIRAFNIYVYNYANAALSVQVIANENARNYQYGAFLDGLDYQSESGYPDFNVGSPFTVPAGSTSAPSVEAIQSDFYTSAAERYLSLALTYSTAPSAGFVRAHIDLFYGGV
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.