Basic Information | |
---|---|
Taxon OID | 2119805007 Open in IMG/M |
Scaffold ID | BSDYNP_contig02124__length_2715___numreads_36 Open in IMG/M |
Source Dataset Name | Hot spring microbial communities from Beowulf Spring, Yellowstone National Park, Wyoming, USA - YNP_Beowulf Spring_D |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 2715 |
Total Scaffold Genes | 6 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (33.33%) |
Novel Protein Genes | 2 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 2 |
Taxonomy | |
---|---|
All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Hot Spring Microbial Communities From Yellowstone National Park, Wyoming, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Wyoming | |||||||
Coordinates | Lat. (o) | 44.733 | Long. (o) | -110.709 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F040183 | Metagenome / Metatranscriptome | 162 | N |
F069055 | Metagenome / Metatranscriptome | 124 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
BSDYNP_00042060 | F040183 | N/A | VKLKYPFPQRFHYLTALGKYLTPNTTIVASGANTGPLTANTVCDFVQTPNHKELAVNLTIQAVSGTFSTGQGLTAYFDVLDPVEPQNVNVNSSERPPVLELKLNSTAITTAPTTIRFIIANGVATVWINGASTALGNVNVPYIWQVRFAITGTSPSFSIVGTYEARE |
BSDYNP_00042070 | F069055 | N/A | LGGVYLTQFSFNQSGLSSSHRFSIISPDPLVTTPRVAGQQSAVVFYAYGAFNNITPPHGRYFEALVLSDIHTNPTNWQGNITLDAYPGGGGCDVSGQYNPDKLGSIFVMPQGNTTSACYACLYNATTDRDVRSGSYNLVIDAMQIRIAYFHPAANVLAFGSDPISFASGVGTIGHCRPQFTTYPDGVPKIIYNDFAFDQSLKTVMEYIDPQVLRPENHKKIYISEDAFPNPIFFSTFGRKKLFARLYFAASGSLVPPTNNPQNDPQYAPVFQIAEYDGNYDYSTGAHYLDNWDVGTLVLGTQEPTTSLSGSIPPSQFSIKQVEFSAEDLPAYVGILMKAQSTNAIGPFGVIVLE |
⦗Top⦘ |