NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold FNTS010_GJXY8QZ02HBP5C

Scaffold FNTS010_GJXY8QZ02HBP5C


Overview

Basic Information
Taxon OID2119805011 Open in IMG/M
Scaffold IDFNTS010_GJXY8QZ02HBP5C Open in IMG/M
Source Dataset NameSoil microbial communities from sample at Multiple FACE and OTC sites
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)509
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → environmental samples → uncultured Acidimicrobiales bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Sand → Desert → Soil → Soil Microbial Communities From Face And Otc Sites In Usa

Source Dataset Sampling Location
Location NameUSA: Sugar bunker, Nevada
CoordinatesLat. (o)36.766667Long. (o)-115.95Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F048859Metagenome / Metatranscriptome147Y

Sequences

Protein IDFamilyRBSSequence
FNTS010_06173250F048859N/AFALLKVRAEDGSASWSVRSGGSPLTMEELLGVLDGLTASLRLRLTRAWKGTLAPTPAASTGDRRAPAPIAFSELLAGLETVGVAESHLIESVFAVIKARRVDGVPVWYVRSAEMRLSSEELLGPPSTGTRPPSAMTWPRPGTW

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.