NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold FNTS067_GJ87FRN01A9WCR

Scaffold FNTS067_GJ87FRN01A9WCR


Overview

Basic Information
Taxon OID2119805012 Open in IMG/M
Scaffold IDFNTS067_GJ87FRN01A9WCR Open in IMG/M
Source Dataset NameSoil microbial communities from sample at FACE Site NTS_067 Nevada Test Site
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)500
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → unclassified Nitrososphaera → Nitrososphaera sp.(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Sand → Desert → Soil → Soil Microbial Communities From Face And Otc Sites In Usa

Source Dataset Sampling Location
Location NameUSA: Nevada, FACE Site NTS_067 Nevada Test Site
CoordinatesLat. (o)36.766667Long. (o)-115.95Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F018295Metagenome / Metatranscriptome236Y

Sequences

Protein IDFamilyRBSSequence
FNTS067_02965920F018295AGGCGGMSTSYFIGGNEASNVPKDSEANTDDKIVIDKLLVNKLTELLINSIYSVHVSRCSEIFLTNLNMHLADFSISNKNDIVCREFTEKSSLLLESYQKGCS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.