NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold FNTS067_GJ87FRN01E4BI9

Scaffold FNTS067_GJ87FRN01E4BI9


Overview

Basic Information
Taxon OID2119805012 Open in IMG/M
Scaffold IDFNTS067_GJ87FRN01E4BI9 Open in IMG/M
Source Dataset NameSoil microbial communities from sample at FACE Site NTS_067 Nevada Test Site
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)519
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Sand → Desert → Soil → Soil Microbial Communities From Face And Otc Sites In Usa

Source Dataset Sampling Location
Location NameUSA: Nevada, FACE Site NTS_067 Nevada Test Site
CoordinatesLat. (o)36.766667Long. (o)-115.95Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F094354Metagenome106Y
F094653Metagenome / Metatranscriptome105Y

Sequences

Protein IDFamilyRBSSequence
FNTS067_05726840F094653AGGGGGVKPQEILEELDRLGISIFHRPQGRGLGQTISVGVGRERAYPELPRAIEERTPELLRLARFEASRHTPATYVRRPGGVS
FNTS067_05726850F094354GGTGGVSVLFALVVSLCAAVLSVLFVTMWLDGDGVTTTALAVALLPMVVLTML

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.