NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold FWIREl_GJ4R3DH01BKPK4

Scaffold FWIREl_GJ4R3DH01BKPK4


Overview

Basic Information
Taxon OID2124908008 Open in IMG/M
Scaffold IDFWIREl_GJ4R3DH01BKPK4 Open in IMG/M
Source Dataset NameSoil microbial communities from sample at FACE Site Metagenome WIR_Elev2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)508
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From Face And Otc Sites In Usa

Source Dataset Sampling Location
Location NameWisconsin Rhinelander (WIR)
CoordinatesLat. (o)45.68Long. (o)-89.63Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F028637Metagenome / Metatranscriptome191Y

Sequences

Protein IDFamilyRBSSequence
FWIREl_05992790F028637GGAGVIIAPGEKVFGALLAIAGVGIILTGHWATTDDMIADLIAGGLMLAFGVLVLLMWSFQR
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.