NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold kg300_3311322

Scaffold kg300_3311322


Overview

Basic Information
Taxon OID2124908010 Open in IMG/M
Scaffold IDkg300_3311322 Open in IMG/M
Source Dataset NameKeratinized_gingiva_contig300
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterLos Alamos National Laboratory
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2033
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Oral Cavity → Unclassified → Keratinized Gingiva → Keratinized Gingiva Microbial Communities From Saint Louis, Missouri, Usa

Source Dataset Sampling Location
Location NameSt. Louis, MO
CoordinatesLat. (o)38.646Long. (o)-90.224Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F063777Metagenome129N

Sequences

Protein IDFamilyRBSSequence
kg300_00994190F063777N/ALKVLNIKISALPPENNSFWMKLLFYLCIPFLFIFGILLLIGWGIYSGISSIISAVKEDFFGIKDKTNIKTSKNILFENEQFKLKKEDYLPDENSQEYKIFDDFCAKSNEYLDDGYILYKLTDEKSATDLNGAIISEFQEDIGNYILLQNLILEDNRLKNQLISFNKNTGKMRVLADIKDFFWLEFDSETKTINGYNNKEQIEIAISE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.