NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold s300_5929643

Scaffold s300_5929643


Overview

Basic Information
Taxon OID2124908011 Open in IMG/M
Scaffold IDs300_5929643 Open in IMG/M
Source Dataset NameHuman Saliva microbiome from visit number 1 of subject 763496533
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterLos Alamos National Laboratory
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)596
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Oral Cavity → Unclassified → Human Saliva → Human Saliva Microbial Communities From Los Alamos National Lab, Usa

Source Dataset Sampling Location
Location NameSt. Louis, MO
CoordinatesLat. (o)38.646Long. (o)-90.224Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F033081Metagenome178Y

Sequences

Protein IDFamilyRBSSequence
s300_01381500F033081N/AQDPKPVFVWPRLVTEIENAGYFSRRKFSILAVGLIIMTIATIKMLLFVPGLNQSVVSLLTRGLETFLPAGWATGAAWTVGMTGVFLMGNFTNYTPSQRFLHKTKATRCEAYNTLLLLALWEEQAFRAGSEKWSWRERVRASMCFGLAHIVNIWYSFAAGIALSVTGFGFLLVYLWYYRKYRSQIIATAAAATVHALYN
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.