NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold sp300_12627952

Scaffold sp300_12627952


Overview

Basic Information
Taxon OID2124908012 Open in IMG/M
Scaffold IDsp300_12627952 Open in IMG/M
Source Dataset NameHuman Subgingival plaque microbiome from visit number 1 of subject 763496533
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterLos Alamos National Laboratory
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1307
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Oral Cavity → Unclassified → Subgingival Plaque → Subgingival Plaque Microbial Communities From Los Alamos National Laboratory, Usa

Source Dataset Sampling Location
Location NameSt. Louis, MO, USA
CoordinatesLat. (o)38.646Long. (o)-90.224Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F051211Metagenome144N

Sequences

Protein IDFamilyRBSSequence
sp300_03283590F051211N/AMRVKKAIRIFEKIRDLPYGTSGSDEVWSCYRKCVLLKQELQHIGITSQLLIGVFDWQDLPIPEHTLNLRRQRHERHVILRVFIDGSTYDIDPSIDIGLAPTLPIAHWDGTSSTATMASLKHLRVYRPHSLHERILSRLRRKLFRGNPKEFYTAIDKWLADTRAHQLF

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.