 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 2124908012 Open in IMG/M |
| Scaffold ID | sp300_12628451 Open in IMG/M |
| Source Dataset Name | Human Subgingival plaque microbiome from visit number 1 of subject 763496533 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Los Alamos National Laboratory |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 4335 |
| Total Scaffold Genes | 7 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 6 (85.71%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Human → Digestive System → Oral Cavity → Unclassified → Subgingival Plaque → Subgingival Plaque Microbial Communities From Los Alamos National Laboratory, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | St. Louis, MO, USA | |||||||
| Coordinates | Lat. (o) | 38.646 | Long. (o) | -90.224 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F105380 | Metagenome | 100 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| sp300_01799050 | F105380 | N/A | MEGRQTQYNINLADLDDQISDGIVYADRSGKMIYKFGAKKIIQTAITKDLTITGLDDEFKMDYYSFWVPDIYLISFKSFNPDGGLYLAYHKKDEKHIYLTNIWPDSRNQDDTYFPNGKRLETKSICTGRMMDDIDSAEYSAWKNDPVTRASQYINKFINARGNADLDFVNSTLRRKVPNHNTKKFAEFLGSITKEQENVNTYEEFIEWTKTTEWFK |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |