Scaffold beta3_all_NODE_128087_len_2049_cov_8_472914

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold beta3_all_NODE_128087_len_2049_cov_8_472914

Scaffold beta3_all_NODE_128087_len_2049_cov_8_472914

Overview

Basic Information
Taxon OID	2124908028 Open in IMG/M
Scaffold ID	beta3_all_NODE_128087_len_2049_cov_8_472914 Open in IMG/M
Source Dataset Name	Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog Site B3
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	2099
Total Scaffold Genes	5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (40.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil → Soil Microbial Communities From Permafrost In Bonanza Creek, Alaska

Source Dataset Sampling Location
Location Name	Bonanza creek, Alaska, USA
Coordinates	Lat. (^o)	64.7	Long. (^o)	-148.3	Alt. (m)		Depth (m)	.3 to .7
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F007147	Metagenome / Metatranscriptome	357	Y

Sequences

Protein ID	Family	RBS	Sequence
beta3_all_00510760	F007147	AGG	MVKRAAKNDGVRRCLAGGVVVFLWTVSLQVRALAENDLLQKAVNYLFTGRTDPQDIPEILDRKSCVVVVPDAKSKQYVRYYLGRFRMDTALIDKTYAGSDTAYNLDIKGAEVIVEYLDIDKSTVLHGYKSAHISLPGDIDQTNKALELIASLCRNGKPKAQF

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.