NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold A2_v1_NODE_42931_len_5025_cov_6_204378

Scaffold A2_v1_NODE_42931_len_5025_cov_6_204378


Overview

Basic Information
Taxon OID2124908029 Open in IMG/M
Scaffold IDA2_v1_NODE_42931_len_5025_cov_6_204378 Open in IMG/M
Source Dataset NamePermafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active Layer A2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5075
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (20.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil → Soil Microbial Communities From Permafrost In Bonanza Creek, Alaska

Source Dataset Sampling Location
Location NameBonanza creek, Alaska, USA
CoordinatesLat. (o)64.7Long. (o)-148.3Alt. (m)Depth (m).3 to .7
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F071798Metagenome / Metatranscriptome122Y

Sequences

Protein IDFamilyRBSSequence
A2_v1_00053750F071798N/AMSSRIGMEAEAITRLTDGLQPPAIRAILVQCLVGELAPSAAVSRMLAAEGPYAVRAAIDDVTHRAATVSRASDMLVHDRVDELTQIFVEKVAELGDVGDTATRRTGYGLPPASRFSGYGNHGDSPKA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.