NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold A2_c1_ConsensusfromContig37760

Scaffold A2_c1_ConsensusfromContig37760


Overview

Basic Information
Taxon OID2124908043 Open in IMG/M
Scaffold IDA2_c1_ConsensusfromContig37760 Open in IMG/M
Source Dataset NamePermafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active Layer A2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)873
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil → Soil Microbial Communities From Permafrost In Bonanza Creek, Alaska

Source Dataset Sampling Location
Location NameBonanza creek, Alaska, USA
CoordinatesLat. (o)64.7Long. (o)-148.3Alt. (m)Depth (m).3 to .7
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001528Metagenome / Metatranscriptome677Y
F008431Metagenome / Metatranscriptome333Y
F037974Metagenome / Metatranscriptome167N

Sequences

Protein IDFamilyRBSSequence
A2_c1_00979260F037974GAGMNHATDILRVKQIVIDEEGNVAKRFPRIDAEGQLKNTLLFAMHPEICVLSMQVP
A2_c1_00979270F001528GGAVCSTTSLAVKKEKPMSEKNQIVVVLIVALFLGAFVDRITALKIVAGVVLLWTLQNQPAVFECIRKLFSFVQRRPSVREYRGGVTTFRAS
A2_c1_00979280F008431N/ATLGRECATEAEAIIEAFREKVNLYKVTEFQTRADIGRSGEPILRKETLKKNNPAS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.