 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 2124908044 Open in IMG/M |
| Scaffold ID | A5_c1_ConsensusfromContig88746 Open in IMG/M |
| Source Dataset Name | Soil microbial communities from permafrost in Bonanza Creek, Alaska, sample from Active Layer A5 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 615 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil → Soil Microbial Communities From Permafrost In Bonanza Creek, Alaska |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Bonanza creek, Alaska, USA | |||||||
| Coordinates | Lat. (o) | 64.7 | Long. (o) | -148.3 | Alt. (m) | Depth (m) | .3 to .7 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F016445 | Metagenome | 247 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| A5_c1_01350370 | F016445 | AGG | MSLMTPKIRIDAKQVAAIIGCARKTVLNGGAGTGQLTRIRNGSKQVRFLLEEVQALAQKQERLAQRHRMSPN |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |