Scaffold KansclcFeb2_ConsensusfromContig314381

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold KansclcFeb2_ConsensusfromContig314381

Scaffold KansclcFeb2_ConsensusfromContig314381

Overview

Basic Information
Taxon OID	2124908045 Open in IMG/M
Scaffold ID	KansclcFeb2_ConsensusfromContig314381 Open in IMG/M
Source Dataset Name	Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	613
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil → Soil Microbial Communities From Great Prairies (Kansas, Wisconsin And Iowa)

Source Dataset Sampling Location
Location Name	Kansas, USA
Coordinates	Lat. (^o)	39.1049	Long. (^o)	-96.6054	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F063678	Metagenome / Metatranscriptome	129	N

Sequences

Protein ID	Family	RBS	Sequence
KansclcFeb2_05276200	F063678	AGGAGG	MGGRDVVAEGTDGDGLAWVIWARRHEPREGDLLSMIRVTDATGRILHGAGRTGPPLYPGHRLNVTSGGGDEGP

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.