NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold contig01681

Scaffold contig01681


Overview

Basic Information
Taxon OID2140918001 Open in IMG/M
Scaffold IDcontig01681 Open in IMG/M
Source Dataset NameHot spring microbial communities from One Hundred Springs Plain, Yellowstone National Park, Wyoming, USA - OSP_D
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2245
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (60.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Hot Spring Microbial Communities From Yellowstone National Park, Wyoming, Usa

Source Dataset Sampling Location
Location NameOne Hundred Springs Plain, Yellowstone National Park
CoordinatesLat. (o)44.7315Long. (o)-110.711389Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F061983Metagenome / Metatranscriptome131Y
F085905Metagenome111N

Sequences

Protein IDFamilyRBSSequence
OSPD_00761420F085905N/AMEEQLSFPSSRLSQFDYVGMNAYWLNTRLRYFTDPMLYAVATGIWVINLMDDVDIAETGTEKNFEYGLIYVYSNSRIDTLFIVALTHYFNVKREREYYRSIPMDALQNVMKSLVDFMNDKLKILDKLKEKIDERVVLMMWNQLYIFVMGFLYGLYGRDAEAVFQGVMARYLLPYSVLEVIRRHLKK
OSPD_00761450F061983AGGAGGLKKYVFKVKVVQIKLINEEGVLSEQEFEHVKKTRIYKGMKVLEIKDLGFDSFWRFTHYYELVAVSEGGGLFNCYYGDVIDVEKLKDVGAIVVKESDGEPLRTMKTLVAKWYNKKLVEEEKAYEVCNTFVT
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.