Scaffold contig00868

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold contig00868

Scaffold contig00868

Overview

Basic Information
Taxon OID	2140918012 Open in IMG/M
Scaffold ID	contig00868 Open in IMG/M
Source Dataset Name	Sediment microbial communities from Lake Washington, Seattle, for Methane and Nitrogen Cycles, sample from flow sorted anaerobic no nitrate
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	2810
Total Scaffold Genes	6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Sediment → Freshwater Sediment Microbial Communities From Lake Washington, Seattle, Usa, For Methane And Nitrogen Cycles

Source Dataset Sampling Location
Location Name	Lake Washington, Seattle
Coordinates	Lat. (^o)	47.676484	Long. (^o)	-122.228394	Alt. (m)		Depth (m)	62
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F050936	Metagenome / Metatranscriptome	144	Y

Sequences

Protein ID	Family	RBS	Sequence
LWFCAn3_00833770	F050936	N/A	MELSNDEVSFLNENIVLKDYFYDLLLNIKNSNETKIILCKNSYERRFVHILAISLGLYHSRYGDWSDWFKKYRDYQETVDKIDGQDHYKIVGVKVSTKLLLLSRKDKIHQECK

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.