Scaffold NODE_2472_length_1424_cov_12.898174

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold NODE_2472_length_1424_cov_12.898174

Scaffold NODE_2472_length_1424_cov_12.898174

Overview

Basic Information
Taxon OID	2140918013 Open in IMG/M
Scaffold ID	NODE_2472_length_1424_cov_12.898174 Open in IMG/M
Source Dataset Name	Soil microbial communities from Great Prairies - Iowa soil (MSU Assemblies)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1456
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil → Soil Microbial Communities From Great Prairies (Kansas, Wisconsin And Iowa)

Source Dataset Sampling Location
Location Name	Iowa, USA
Coordinates	Lat. (^o)	41.827222	Long. (^o)	-93.008611	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F036912	Metagenome	169	Y

Sequences

Protein ID	Family	RBS	Sequence
Iowa-Corn-GraphCirc_03225010	F036912	N/A	TSQVAKGELGGAMNGQSVERLMDIILQMKINLAHINETLVQQTYEIREQLGLLFNEEKGTLERCLCAIDEKLQDCSTLIVDYQRRHADLAAMREKLVQLDAEPAAMPPPLPSDTVENIIAWRLGEIKAGARP

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.