NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold NODE_261707_length_596_cov_6.000000

Scaffold NODE_261707_length_596_cov_6.000000


Overview

Basic Information
Taxon OID2140918024 Open in IMG/M
Scaffold IDNODE_261707_length_596_cov_6.000000 Open in IMG/M
Source Dataset NamePermafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog_all
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)646
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil → Soil Microbial Communities From Permafrost In Bonanza Creek, Alaska

Source Dataset Sampling Location
Location NameBonanza creek, Alaska, USA
CoordinatesLat. (o)64.7Long. (o)-148.3Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002448Metagenome / Metatranscriptome558Y
F010139Metagenome / Metatranscriptome308Y

Sequences

Protein IDFamilyRBSSequence
B_all_v_01108500F002448N/AMINAKKIGLEFVAALQSLPNLLEALGGDADSIQYYSENRVVFGRRTQNNTREAILSMPLGSIMIVWQGSGPGRLGNAQVYAHNYSLYLRAPEIEDVGYEDICDWIVNDVPVGGSLKMLHTPIDPNCEPMDFQLPNSQRNTVVISADGTTFEYFEVPVRLIESFNP
B_all_v_01108510F010139GGAGMKVFMKSPQGDEIKEVEATAAALSPLMSAGWHQVPAPASEQPA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.