Scaffold NODE_471399_length_19299_cov_13.642675

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold NODE_471399_length_19299_cov_13.642675

Scaffold NODE_471399_length_19299_cov_13.642675

Overview

Basic Information
Taxon OID	2140918024 Open in IMG/M
Scaffold ID	NODE_471399_length_19299_cov_13.642675 Open in IMG/M
Source Dataset Name	Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog_all
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	19349
Total Scaffold Genes	23 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	16 (69.57%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil → Soil Microbial Communities From Permafrost In Bonanza Creek, Alaska

Source Dataset Sampling Location
Location Name	Bonanza creek, Alaska, USA
Coordinates	Lat. (^o)	64.7	Long. (^o)	-148.3	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F024934	Metagenome	204	Y

Sequences

Protein ID	Family	RBS	Sequence
B_all_v_02298420	F024934	GGAGG	MPADAEFAKKIIKMRVRYVLEQSQGQILDEKKIKNIADKVRQGENNRAVADEIKKLTLNGIEKAKPLLKEVVKQLLDEYAQSIKEITDEAILEMVSGEIQKMAEEQAEK

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.