Scaffold STU__NODE_10381_len_662_cov_8_090634

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold STU__NODE_10381_len_662_cov_8_090634

Scaffold STU__NODE_10381_len_662_cov_8_090634

Overview

Basic Information
Taxon OID	2149837018 Open in IMG/M
Scaffold ID	STU__NODE_10381_len_662_cov_8_090634 Open in IMG/M
Source Dataset Name	Human fecal microbial communities from the University of Arizona (HMP) - Em1
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Chinese National Human Genome Center, Beijing
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	690
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From The University Of Arizona, For Hmp Training

Source Dataset Sampling Location
Location Name	Bording, Denmark
Coordinates	Lat. (^o)	56.13	Long. (^o)	9.24	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F042936	Metagenome	157	N

Sequences

Protein ID	Family	RBS	Sequence
STU_0980.00000620	F042936	N/A	LRQGPFCCVRLMGRGGGKGRVWKTKEGIMKTSGIVDRGEDTIRNFEKVEQEGALTPPYLGKVYFRSRLRGKG

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.