NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold STU__NODE_400_len_8436_cov_19_801802

Scaffold STU__NODE_400_len_8436_cov_19_801802


Overview

Basic Information
Taxon OID2149837021 Open in IMG/M
Scaffold IDSTU__NODE_400_len_8436_cov_19_801802 Open in IMG/M
Source Dataset NameHuman fecal microbial communities from the University of Arizona (HMP) - UAf1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterChinese National Human Genome Center, Beijing
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)8494
Total Scaffold Genes10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From The University Of Arizona, For Hmp Training

Source Dataset Sampling Location
Location NameArizona, USA
CoordinatesLat. (o)32.23Long. (o)-110.95Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F073573Metagenome120N
F101192Metagenome102N

Sequences

Protein IDFamilyRBSSequence
STU_0387.00000060F073573AGGAGGMPSIVSFYQRFPNEAPPLNLSAFDHTGYTYAENFRRNERCYEAEQCEVTSDDGSVVLSLDVRIRPRGGEIEALPRVMLSVYSEGMLFQVRRMELRTGDTTYAILPDNVQQYTKRGDTDGGFLETMAIPLGKVGMKMLLEASDAAEARWVIQGARTAQTLPLTAAQKKAIHRFCMDCEESAITYQPAFLWYKDYCTKA
STU_0387.00000090F101192GGGGGMQTEPNDKEGRNMTYWGWLLVDIALLLTALSGTQTSLCQRMRSVPVYRGLTYWEVQQIAKDAPTSFTPCGEDTIRRWVSGRYQIALRFNRYDICLGVEEEIDG
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.