Scaffold STU__NODE_4249_len_6806_cov_18_842491

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold STU__NODE_4249_len_6806_cov_18_842491

Scaffold STU__NODE_4249_len_6806_cov_18_842491

Overview

Basic Information
Taxon OID	2149837021 Open in IMG/M
Scaffold ID	STU__NODE_4249_len_6806_cov_18_842491 Open in IMG/M
Source Dataset Name	Human fecal microbial communities from the University of Arizona (HMP) - UAf1
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Chinese National Human Genome Center, Beijing
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	6864
Total Scaffold Genes	7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	6 (85.71%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From The University Of Arizona, For Hmp Training

Source Dataset Sampling Location
Location Name	Arizona, USA
Coordinates	Lat. (^o)	32.23	Long. (^o)	-110.95	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F091068	Metagenome	108	N

Sequences

Protein ID	Family	RBS	Sequence
STU_0065.00001850	F091068	AGGAGG	MNEKNQHVSDEQIDALIRSGLWQDEQPLTADEEKLADAAFARAMAKIDRKAKRQKHRTVLHMLDRVVRVAACLIVAVGIAFPIALANSEAFREQILQLVLSINPETGMAHVGMKPAKEEQTANVPRMDVPDGWEGLFFPTFLPDSLPLVRCETTRGDQVHSEAYYADETRSLRFEEQDNLDGWNVRAADARVLTIYLHSVPGYLIDRQTEDTHEVSIIWSEGKRMLRVTSIGLPADEAVLVAQSVKKIFAE

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.