NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold STU__NODE_6647_len_1530_cov_23_492811

Scaffold STU__NODE_6647_len_1530_cov_23_492811


Overview

Basic Information
Taxon OID2149837021 Open in IMG/M
Scaffold IDSTU__NODE_6647_len_1530_cov_23_492811 Open in IMG/M
Source Dataset NameHuman fecal microbial communities from the University of Arizona (HMP) - UAf1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterChinese National Human Genome Center, Beijing
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1588
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From The University Of Arizona, For Hmp Training

Source Dataset Sampling Location
Location NameArizona, USA
CoordinatesLat. (o)32.23Long. (o)-110.95Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F059982Metagenome133N

Sequences

Protein IDFamilyRBSSequence
STU_0347.00000960F059982GGAGGMTMRRMTRLLCLMLLFSLITFSCPLAEETDAPTGTPAPTPMLTAVPESALAPFNVVLPEDAHVEMAEGRITLVRGDSRVVAMVISRVPDDDPAAALPILMQDFDPKTSETMDFDAQPGFCILGGVVNDAFGDGEDKITLMVLADSGELLILSGYNLARDHHALYLFLTELLENVSMDGEAVYVAEDAAATASPEV

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.