Basic Information | |
---|---|
Taxon OID | 2149837021 Open in IMG/M |
Scaffold ID | STU__NODE_7266_len_2179_cov_14_657641 Open in IMG/M |
Source Dataset Name | Human fecal microbial communities from the University of Arizona (HMP) - UAf1 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Chinese National Human Genome Center, Beijing |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 2237 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From The University Of Arizona, For Hmp Training |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Arizona, USA | |||||||
Coordinates | Lat. (o) | 32.23 | Long. (o) | -110.95 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F073574 | Metagenome | 120 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
STU_0931.00001300 | F073574 | AGGAGG | MLLPAAVRPYAADVDGTACRVRCAIALNGSKELHIQLCGRLKRGLFGRNQLLADGDVLCVALHQPDGDVPLFDSRCDGYANVLDDRQPPAPIPLHPAICPKCRNAAFQVDLSFEYPDAEELAAFANPDDMFTWVWVTMRCTRCHAVFRGDLECD |
⦗Top⦘ |