 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 2162886011 Open in IMG/M |
| Scaffold ID | MRS1b_contig_6714978 Open in IMG/M |
| Source Dataset Name | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 973 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere → Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan State University, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Kellogg Biological Station, Michigan State University | |||||||
| Coordinates | Lat. (o) | 42.406189 | Long. (o) | -85.40016 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F040708 | Metagenome | 161 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| MRS1b_0168.00000140 | F040708 | N/A | VNAIRLAASLFILVLIGVSAMGWVWTGTHQPPAQALAGRSVLALAALAGVIGLVALWRWPERT |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |