Scaffold FOassembled-_contig17548

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold FOassembled-_contig17548

Scaffold FOassembled-_contig17548

Overview

Basic Information
Taxon OID	2162886015 Open in IMG/M
Scaffold ID	FOassembled-_contig17548 Open in IMG/M
Source Dataset Name	Grass soil microbial communities from Rothamsted Park, UK - FO (Mercury 0.02g/kg) assembled
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	454 Life Sciences
Sequencing Status	Finished

Scaffold Components
Scaffold Length (bps)	860
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil → Grass Soil Microbial Communities From Rothamsted Park Plot 3D, Harpenden, Uk

Source Dataset Sampling Location
Location Name	United Kingdom: Rothamsted, Harpenden
Coordinates	Lat. (^o)	51.804241	Long. (^o)	-0.372114	Alt. (m)		Depth (m)	0 to .21
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F022707	Metagenome	213	Y

Sequences

Protein ID	Family	RBS	Sequence
FOassembled-_0548.00001440	F022707	N/A	MKLLSRRALDQLGTLQANVQELAAHRNTALRMFIASRSTTTPVAQREFWLEFAWVDQEYRIAVRRLAQFCTDHQDSSHTRWRANTVCR

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.