Basic Information | |
---|---|
Taxon OID | 2166559005 Open in IMG/M |
Scaffold ID | cont_contig117257 Open in IMG/M |
Source Dataset Name | Simulated microbial communities from Lyon, France |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | 454 Life Sciences |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 503 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Engineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated → Simulated Microbial Communities From Lyon, France |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Lyon, France | |||||||
Coordinates | Lat. (o) | 45.7580538 | Long. (o) | 4.7649095 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F036361 | Metagenome / Metatranscriptome | 170 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
cont_0013.00006880 | F036361 | GAGG | MREIIINELTQALQDLARGFAHYLPRLVVMLIIAFVGWMSPTY |
⦗Top⦘ |