 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 2166559011 Open in IMG/M |
| Scaffold ID | E4LJNJL01A2TZH Open in IMG/M |
| Source Dataset Name | Human fecal microbial communities from France, for comparison studies - Human5 (TS28 0613) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | 454 Life Sciences |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 538 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Human → Digestive System → Large Intestine → Fecal → Environmental And Host-Associated → Microbial Communities From The Atlantic Ocean And Human Feces From France, Grouped Together For A Comparative Study |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | St. Chamond, France | |||||||
| Coordinates | Lat. (o) | 45.460129 | Long. (o) | 4.495284 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F068855 | Metagenome | 124 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Human5-_00269490 | F068855 | N/A | VPTVEAQGPQVRKSLALQGLQAEKERENANVQNAGWLHSFDADYHYHGSDLHYHVNVSAALSEGGTVW |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |