NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold GJ61VE201D6THV

Scaffold GJ61VE201D6THV


Overview

Basic Information
Taxon OID2170459007 Open in IMG/M
Scaffold IDGJ61VE201D6THV Open in IMG/M
Source Dataset NameGrass soil microbial communities from Rothamsted Park, UK - March 2009 indirect in plug lysis (for fosmid construction) 10-21cm
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center454 Life Sciences
Sequencing StatusFinished

Scaffold Components
Scaffold Length (bps)515
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil → Grass Soil Microbial Communities From Rothamsted Park Plot 3D, Harpenden, Uk

Source Dataset Sampling Location
Location NameRothamsted, Harpenden, UK
CoordinatesLat. (o)51.804241Long. (o)-0.372114Alt. (m)Depth (m).1 to .21
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F088465Metagenome / Metatranscriptome109N

Sequences

Protein IDFamilyRBSSequence
L02_03194500F088465N/ANALQXTRDLRLNFGADLRGELWDRFGAFNTIGPGASAGLRYRFGLGRQAPWVLLEDRFGYDRFQDTAQSGYDNVLNFQAGIALSDRIALEGGYAFESFVAPDDFYDRQVHRGNASIVFDVTSSLQVTAGYIYREGDVISYAVPPRPDIARFSIKREDEDEFGQPLRTAYKL

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.