Scaffold GZGWRS402IW1AN

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold GZGWRS402IW1AN

Scaffold GZGWRS402IW1AN

Overview

Basic Information
Taxon OID	2189573004 Open in IMG/M
Scaffold ID	GZGWRS402IW1AN Open in IMG/M
Source Dataset Name	Grass soil microbial communities from Rothamsted Park, UK - FG2 (Nitrogen)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	454 Life Sciences
Sequencing Status	Finished

Scaffold Components
Scaffold Length (bps)	517
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil → Grass Soil Microbial Communities From Rothamsted Park Plot 3D, Harpenden, Uk

Source Dataset Sampling Location
Location Name	Rothamsted, Harpenden, UK
Coordinates	Lat. (^o)	51.804241	Long. (^o)	-0.372114	Alt. (m)		Depth (m)	0 to .21
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F001404	Metagenome / Metatranscriptome	704	Y

Sequences

Protein ID	Family	RBS	Sequence
FG2_05809950	F001404	GAG	MGELRCARFSLFAVAAALTATGFGVWAASTTNARVAPSVGQGTEPIQVMMTAKDLPTVEFADYTFVFAH

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.