NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold 2199858397

Scaffold 2199858397


Overview

Basic Information
Taxon OID2199352004 Open in IMG/M
Scaffold ID2199858397 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, WI - Practice 15JUN2010 epilimnion
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4383
Total Scaffold Genes16 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)10 (62.50%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameLake Mendota, Madison, WI
CoordinatesLat. (o)43.098333Long. (o)-89.405278Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007265Metagenome / Metatranscriptome354Y
F024290Metagenome / Metatranscriptome206Y
F036765Metagenome / Metatranscriptome169Y
F049618Metagenome / Metatranscriptome146N

Sequences

Protein IDFamilyRBSSequence
2200045941F036765N/AMTIKATELLKLFTKAKQLDLSVEVREDKDGDYVIRIYEMFHPEGFDETVFINQEGETNWDKRCYSFDYMMDVLDEMLEEKRQEKIKEQKRQELLARLTDFEKDLLGVK
2200045943F024290GAGMTFEEILEEYGQEVLDTYYELFPDKNVSKFGDRCCGFVGEYQDFVLDCYHSTGSDELETLEDFMNGVFQEYYYYCEKTATGFVFYNER
2200045946F049618GGAGMRIEITYTPHPTKGYTATIWDGPDGIDEDSFVCRSLGECFEQIVMWRTLNAQQYKDE
2200045950F007265AGTAGGMISPYNVVPGTDIVHSITDVYELCDEAEGCTHTVKLNADNGGVYLESTGKQHDSEHRGITEYMTIGNKELAIVVAKRILELYGV
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.