NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold 2199913426

Scaffold 2199913426


Overview

Basic Information
Taxon OID2199352004 Open in IMG/M
Scaffold ID2199913426 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, WI - Practice 15JUN2010 epilimnion
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2480
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (50.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameLake Mendota, Madison, WI
CoordinatesLat. (o)43.098333Long. (o)-89.405278Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003750Metagenome / Metatranscriptome470Y
F004476Metagenome / Metatranscriptome436Y
F008494Metagenome / Metatranscriptome332N

Sequences

Protein IDFamilyRBSSequence
2200098917F004476AGAAGMLFSKHGFKSVDTTEEFVKQAIEFGQKDIVLSVVHDNGVIDIVISPTMDAIEAEVYHFLNDDTELKYSMPIKTLTDNNISSLALTSAIHAYLSEAFKVAEMFRSTTRQSTDYAK
2200098918F003750N/AMNEEILHRVMQVVIYTGGIVAFWQITKHMPKALYTLLECISVMACSVLLLTPIAMIIEYILGGNIHTTMMFVGCLAGVGLLCGIWMVMVQSSRELQGKKQYKYVVL
2200098919F008494AGGAGMTKKEVITMFMNAVGQYTTAIDKTAETNINYKKSVYALEDAVNLIYREVDPKELGSNAEARNAKVSQKTQDLIIAKREAEFILETARANESRIKAEVDQIKYIIRALEVKEEA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.