Scaffold 2200349930

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold 2200349930

Scaffold 2200349930

Overview

Basic Information
Taxon OID	2199352009 Open in IMG/M
Scaffold ID	2200349930 Open in IMG/M
Source Dataset Name	Marine subseafloor sediment microbial communities, sample from White Oak River Estuary, NC, USA 14E
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	8254
Total Scaffold Genes	12 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	10 (83.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Archaea → Candidatus Thermoplasmatota → Thermoplasmata → Thermoplasmatales → unclassified Thermoplasmatales → Thermoplasmatales archaeon SG8-52-1	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine Sediment → Marine Sediment Microbial Communities From The Peru Margin, Gulf Of Mexico And South Pacific Gyre

Source Dataset Sampling Location
Location Name	White Oak River Estuary, North Carolina, subseafloor sediments from , Sample 14E; 24 centimeters below seafloor
Coordinates	Lat. (^o)	34.690251	Long. (^o)	-77.106571	Alt. (m)		Depth (m)	.24
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F014681	Metagenome / Metatranscriptome	261	Y

Sequences

Protein ID	Family	RBS	Sequence
2200743616	F014681	AGG	MKLRSLKNNIRAIINIELILMIGIAFAGMMVGAFIIWTLVDSLGATGDAALSIANITTGFDSTVNLLLVAITIFILALAISALLLLRQR

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.