NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold QLA_contig28555.28555

Scaffold QLA_contig28555.28555


Overview

Basic Information
Taxon OID2199352018 Open in IMG/M
Scaffold IDQLA_contig28555.28555 Open in IMG/M
Source Dataset NameSaline water microbial communities from Qinghai Lake, Tibetan Plateau -Sample 11630
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Illinois, Urbana-Champaign
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)564
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water → Saline Water Microbial Communities From A Tibetan Plateau Lake

Source Dataset Sampling Location
Location NameQinghai Lake, Tibetan Plateau
CoordinatesLat. (o)36.381Long. (o)100.218Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F010908Metagenome / Metatranscriptome297Y

Sequences

Protein IDFamilyRBSSequence
QLA_00076460F010908GAGGMRQILSPFQKYECFAVDGTDYLVVDYTIVQDNDDNLVDWASEMKFKRLKDHKHYTMPISKIITNYNEGRAKLCKCK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.