Basic Information | |
---|---|
Taxon OID | 2199352018 Open in IMG/M |
Scaffold ID | QLA_contig31201.31201 Open in IMG/M |
Source Dataset Name | Saline water microbial communities from Qinghai Lake, Tibetan Plateau -Sample 11630 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Illinois, Urbana-Champaign |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 522 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water → Saline Water Microbial Communities From A Tibetan Plateau Lake |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Qinghai Lake, Tibetan Plateau | |||||||
Coordinates | Lat. (o) | 36.381 | Long. (o) | 100.218 | Alt. (m) | Depth (m) | 1 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F061869 | Metagenome / Metatranscriptome | 131 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
QLA_00123670 | F061869 | GGAG | MSTYYFGQSPEEALGNSPRYFYAFHRNEDGELFLLRSDQLKDKDSININLPGSPAETFEDFEPGVDYFEGIQSNHEKEYDNMFWTQYKWDQRSILYYIDEEGMLVQRVNQNYTYPLGTSGDY |
⦗Top⦘ |