NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold deeps_contig26294.16947

Scaffold deeps_contig26294.16947


Overview

Basic Information
Taxon OID2199352024 Open in IMG/M
Scaffold IDdeeps_contig26294.16947 Open in IMG/M
Source Dataset NameBare-fallow DEEP SOIL
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterArgonne National Laboratory
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2064
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (83.33%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From Rothamsted, Uk, For Project Deep Soil

Source Dataset Sampling Location
Location NameUnited Kingdom Rothamsted
CoordinatesLat. (o)56.03Long. (o)-2.82Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F012273Metagenome / Metatranscriptome282Y

Sequences

Protein IDFamilyRBSSequence
deeps_03131890F012273AGGAGMRLSKLSVIVAIAVIALAFSVPAFAAGNEPCKVLTAEKFSQIMGYTATIDKTGSNQTSCVYQGPPKSGGQFMILTETASGPRADAILARRGSSPPAASGLIGGTYRQGSTIFYVSIRSTDQAKLQALVAEIKHNLK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.