Scaffold 2222184199

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold 2222184199

Scaffold 2222184199

Overview

Basic Information
Taxon OID	2222084001 Open in IMG/M
Scaffold ID	2222184199 Open in IMG/M
Source Dataset Name	Marine microbial communities from Deepwater Horizon oil blowout, Alabama, USA - Dispersant
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Alabama State University
Sequencing Status	Finished

Scaffold Components
Scaffold Length (bps)	515
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Oil-Contaminated → Marine → Marine Microbial Communities From Deepwater Horizon Oil Blowout, Alabama, Usa

Source Dataset Sampling Location
Location Name	Daulphin Laboratory, Alabama, USA
Coordinates	Lat. (^o)	30.15	Long. (^o)	-88.446	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F034589	Metagenome / Metatranscriptome	174	Y

Sequences

Protein ID	Family	RBS	Sequence
2222218527	F034589	N/A	LKEQPNPVDAFTQYDYEFIKKQLQNYLDPGSVEEDAPAALPGGTDSELPASLGSNKTDFTLETATAGNKDTVSKFDDLFNE

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.