NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold 2225734537

Scaffold 2225734537


Overview

Basic Information
Taxon OID2222084010 Open in IMG/M
Scaffold ID2225734537 Open in IMG/M
Source Dataset NameCoastal lagoon microbial communities from Mar Menor, Spain - Sample 1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity Miguel Hernandez
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)699
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Coastal Lagoon → Coastal Lagoon Microbial Communities From Mar Menor And Albufera, Spain

Source Dataset Sampling Location
Location NameMar Menor, Spain
CoordinatesLat. (o)37.72955Long. (o)-0.7741Alt. (m)Depth (m)4
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F015349Metagenome / Metatranscriptome255Y
F081915Metagenome / Metatranscriptome114N

Sequences

Protein IDFamilyRBSSequence
2225116008F015349N/AGQYFNKGGWHTPDIIKTGPDGIEIDKLTIEMVNADGFKVFNEIEYDGEVYYLEEDSTGKSSSFYVAKGDNLK
2225116009F081915AGGAGMTYRKNTYYTQELDSDTLNSMITVSFSRESDLTQSVLRWAVSEDMIKTRYELDIAYETVSDLNNWPEGEGYGSSDRAGDLRSIQDTVESSRRYIKAEKELWIVNDKEPLVGTVLAYMAMMDKIKAGLTEGGQ

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.