Scaffold PC6_p0550622

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold PC6_p0550622

Scaffold PC6_p0550622

Overview

Basic Information
Taxon OID	2236876023 Open in IMG/M
Scaffold ID	PC6_p0550622 Open in IMG/M
Source Dataset Name	Saline water concentrator pond microbial communities from Bras del Port saltern, Spain - PC6
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	GATC-Biotech AG, Konstanz, Germany
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1000
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (33.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water Concentrator Pond → Saline Water Concentrator Pond Microbial Communities From Bras Del Port Saltern, Santa Pola, Spain

Source Dataset Sampling Location
Location Name	Punta Cormorant, Spain
Coordinates	Lat. (^o)	38.11	Long. (^o)	-0.36	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F034000	Metagenome	176	Y

Sequences

Protein ID	Family	RBS	Sequence
PC6_05506222	F034000	N/A	MTRRQQLFKIAAQLVELTTEEELEYYPFLDHLQDLIDDLEMEEGK

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.