NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold ICChiseqgaiiDRAFT_c0899153

Scaffold ICChiseqgaiiDRAFT_c0899153


Overview

Basic Information
Taxon OID3300000033 Open in IMG/M
Scaffold IDICChiseqgaiiDRAFT_c0899153 Open in IMG/M
Source Dataset NameSoil microbial communities from Great Prairies - Iowa, Continuous Corn soil
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)9087
Total Scaffold Genes14 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)11 (78.57%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Microgenomates group → Candidatus Gottesmanbacteria → Candidatus Gottesmanbacteria bacterium GW2011_GWB1_49_7(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil → Soil Microbial Communities From Great Prairies (Kansas, Wisconsin And Iowa)

Source Dataset Sampling Location
Location NameUSA: Maryland: Natonal Institute of Health
CoordinatesLat. (o)39.0042816Long. (o)-77.1012173Alt. (m)Depth (m).1016
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F062887Metagenome / Metatranscriptome130Y

Sequences

Protein IDFamilyRBSSequence
ICChiseqgaiiDRAFT_089915312F062887N/AMPTRKTKGGGYKYGGSGKTYYGKGAKAKANKQGRAIRASQHKKK*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.