Scaffold HCE12Call500_c0293898

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold HCE12Call500_c0293898

Scaffold HCE12Call500_c0293898

Overview

Basic Information
Taxon OID	3300000035 Open in IMG/M
Scaffold ID	HCE12Call500_c0293898 Open in IMG/M
Source Dataset Name	Hoatzin crop microbial communities from Cojedes, Venezuela - Epithelial fraction 12
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	7541
Total Scaffold Genes	9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	3 (33.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Opisthokonta	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Birds → Digestive System → Crop → Lumen → Hoatzin Crop → Hoatzin Crop Microbial Communities From Cojedes, Venezuela

Source Dataset Sampling Location
Location Name	Cojedes, Venezuela
Coordinates	Lat. (^o)	8.956944	Long. (^o)	-68.299167	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F004001	Metagenome	457	Y

Sequences

Protein ID	Family	RBS	Sequence
HCE12Call500_02938989	F004001	N/A	AVVESPSLEEFKNRVDVALHDMVFSRHHGVGVTVGLDDLRGLF*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.