NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold LCrCPGB2aDRAFT_c004460

Scaffold LCrCPGB2aDRAFT_c004460


Overview

Basic Information
Taxon OID3300000095 Open in IMG/M
Scaffold IDLCrCPGB2aDRAFT_c004460 Open in IMG/M
Source Dataset NameSoil microbial communities from Colorado Plateau, Green Butte sample - Light Crust, Colorado Plateau, Green Butte 2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)2530
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (60.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales → Microcoleaceae → Microcoleus → environmental samples → uncultured Microcoleus sp.(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Sand → Desert → Soil → Soil Microbial Communities From Four Geographically Distinct Crusts In The Colorado Plateau And Sonoran Desert

Source Dataset Sampling Location
Location NameUSA: Maryland: Natonal Institute of Health
CoordinatesLat. (o)39.0042816Long. (o)-77.1012173Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F011201Metagenome / Metatranscriptome293Y
F042710Metagenome157N
F083444Metagenome113Y

Sequences

Protein IDFamilyRBSSequence
LCrCPGB2aDRAFT_0044603F042710GGAGMSENSGENCDRSQNFTASSARDCRYVDVLKARAEELGLDSNCVGDKRKRETWEVLLETHGEDKPLKPQFVAKPNQP*
LCrCPGB2aDRAFT_0044604F083444GAGGMLNNMSEVFSCEEVALENTHLLPEYGKKVIYFVTAMQGESKTFLYIGFTINLRRKFKSHHRKIEFEFLNRIGYQIKISWIVLPNGIREKEGHVVQRCYIQAFEPKLNEDQNSIATVQAEELKKQFENWELRRYEYLKKEIENWEQSGDDKDTIIKKIWEVCKEPFEDKNLTLCSCKPQKTGV*
LCrCPGB2aDRAFT_0044605F011201N/AMKKSKAKSKTRHGGARTGAGRPRRWKHGPLKMVRLPVAFVEEILEIAQYMDQNDGRLPFSEVSEASVLISAHASESFSGEEIKELSAKRKAQKLAQKVMAGDDWVLVSDETFAGF*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.