NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold LCrCPGB2aDRAFT_c037732

Scaffold LCrCPGB2aDRAFT_c037732


Overview

Basic Information
Taxon OID3300000095 Open in IMG/M
Scaffold IDLCrCPGB2aDRAFT_c037732 Open in IMG/M
Source Dataset NameSoil microbial communities from Colorado Plateau, Green Butte sample - Light Crust, Colorado Plateau, Green Butte 2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)869
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales → Microcoleaceae → Tychonema → unclassified Tychonema → Tychonema sp. LEGE 06208(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Sand → Desert → Soil → Soil Microbial Communities From Four Geographically Distinct Crusts In The Colorado Plateau And Sonoran Desert

Source Dataset Sampling Location
Location NameUSA: Maryland: Natonal Institute of Health
CoordinatesLat. (o)39.0042816Long. (o)-77.1012173Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F006886Metagenome / Metatranscriptome362Y

Sequences

Protein IDFamilyRBSSequence
LCrCPGB2aDRAFT_0377322F006886N/AMYSEFDASEFDYLNSATPQQFEQQNPVKAPEVTNIERFWTLTGNWGEFGSYXGAGLSASLVVRAIXALIPAAVILIPAAGLGLLIHSLAVDGAAKLRSQLILIAVGTALIAANWDAWQAWIIANSQLLIFSAAVIVITLGFVGTQIWSKLSNVSK*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.