Scaffold DelMOSum2010_c10001568

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold DelMOSum2010_c10001568

Scaffold DelMOSum2010_c10001568

Overview

Basic Information
Taxon OID	3300000101 Open in IMG/M
Scaffold ID	DelMOSum2010_c10001568 Open in IMG/M
Source Dataset Name	Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Draft

Scaffold Components
Scaffold Length (bps)	18281
Total Scaffold Genes	33 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	18 (54.55%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine → Marine Microbial Communities From Delaware Coast

Source Dataset Sampling Location
Location Name	Microbial Observatory off the coast of Delaware, USA
Coordinates	Lat. (^o)	38.84917	Long. (^o)	-75.1076	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F005010	Metagenome	415	Y

Sequences

Protein ID	Family	RBS	Sequence
DelMOSum2010_1000156810	F005010	GGA	MFRKRKHIKRTEAYLRMLELDQINLTLHASRFGWSTDIQHQLTNSAMLIRKYQRRLRLIRM*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.