NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold DelMOSum2011_c10015435

Scaffold DelMOSum2011_c10015435


Overview

Basic Information
Taxon OID3300000115 Open in IMG/M
Scaffold IDDelMOSum2011_c10015435 Open in IMG/M
Source Dataset NameMarine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)3815
Total Scaffold Genes10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (10.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine → Marine Microbial Communities From Delaware Coast

Source Dataset Sampling Location
Location NameMicrobial Observatory off the coast of Delaware, USA
CoordinatesLat. (o)38.848917Long. (o)-75.1076Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F006200Metagenome / Metatranscriptome379Y
F013232Metagenome / Metatranscriptome273Y
F057685Metagenome / Metatranscriptome136N

Sequences

Protein IDFamilyRBSSequence
DelMOSum2011_100154354F006200N/AMANKTEDWLEELVKKYSIPTEEKTDKRGMLNETQLKNLKNGKN*
DelMOSum2011_100154355F057685N/AMGGSVDASWTCGCGSLNAGWRTTCGGCEEKEIMANKTPRKDLLKILNTIKEDFEMLQDGSWSLQYSDGSEIEASLDNVDKAIQIVNKDLYGK*
DelMOSum2011_100154356F013232N/AMSDREIMNAKSGVPMWWKPGIAFLKQDWINHPHLKQFRNKKSTDSNCDCSSPKLVELWEHDSCVRGRIDTTVCVKCNEVESLSIVR*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.