NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold DelMOSpr2010_c10020991

Scaffold DelMOSpr2010_c10020991


Overview

Basic Information
Taxon OID3300000116 Open in IMG/M
Scaffold IDDelMOSpr2010_c10020991 Open in IMG/M
Source Dataset NameMarine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)3187
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine → Marine Microbial Communities From Delaware Coast

Source Dataset Sampling Location
Location NameMicrobial Observatory off the coast of Delaware, USA
CoordinatesLat. (o)38.848917Long. (o)-75.1076Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F078416Metagenome / Metatranscriptome116N

Sequences

Protein IDFamilyRBSSequence
DelMOSpr2010_100209914F078416AGGAGMTAIKKFHTTGQEGCDDCQWLANETDGEWLCCDECXWVLNGXDDGQPDWAQEWHDFDPEC
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.